PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun007979
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 297aa    MW: 33745.3 Da    PI: 4.4558
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-34045PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.7e-1957110356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ +q+++Le+ Fe ++++  +++ +LA++lgL+ rqV vWFqNrRa++k
  Vun007979  57 KKRRLSVDQVKALEKNFEVENKLEPDRKVKLAQELGLQPRQVAVWFQNRRARWK 110
                566899***********************************************9 PP

2HD-ZIP_I/II130.47e-4256148193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrls +qvk+LE++Fe e+kLep+rKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++yd+lk + ++L++++e+L +e+ke
    Vun007979  56 EKKRRLSVDQVKALEKNFEVENKLEPDRKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDSLKLNYDTLQQDNEALLKEIKE 148
                  69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.41E-1938114IPR009057Homeodomain-like
PROSITE profilePS5007117.32952112IPR001356Homeobox domain
SMARTSM003898.6E-1855116IPR001356Homeobox domain
CDDcd000861.78E-1657113No hitNo description
PfamPF000464.3E-1657110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.8E-2059119IPR009057Homeodomain-like
PRINTSPR000318.0E-68392IPR000047Helix-turn-helix motif
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PRINTSPR000318.0E-692108IPR000047Helix-turn-helix motif
PfamPF021834.8E-17112153IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MKRLGSSDSL GALMTICPTT DEHSPRNNHV YGREFQSMLE GLDDEGCVEE PGHHAEKKRR  60
LSVDQVKALE KNFEVENKLE PDRKVKLAQE LGLQPRQVAV WFQNRRARWK TKQLERDYGV  120
LKANYDSLKL NYDTLQQDNE ALLKEIKELK SRLLLQEESN TESDVSVKEE MITLQDSNPL  180
CETAIPGSEC FNKSDEVLGG FKDGSSDSDS SAILNEENAN NNDNSPNNAT ISSSGVMQSQ  240
SFLSSSSPMN CFQFQKQFPT QYVKMEEHNF LSADEACNFF SDEQAPTLQW YCSEEWS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104112RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510048.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
SwissprotQ940J12e-82ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLA0A0L9TJK40.0A0A0L9TJK4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3QYJ60.0A0A0S3QYJ6_PHAAN; Uncharacterized protein
STRINGGLYMA05G30940.11e-159(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.19e-75homeobox protein 16